Story cover for W̵̬̒ḭ̷́ĺ̷͓f̵̝͋o̷͓͠r̶̭͝d̸̼̍ X READER (ON HOLD) by Horroryas
W̵̬̒ḭ̷́ĺ̷͓f̵̝͋o̷͓͠r̶̭͝d̸̼̍ X READER (ON HOLD)
Horroryas
  • Reads 69,356
  • Votes 2,861
  • Parts 28
  • Time 2h 59m
  • Reads 69,356
  • Votes 2,861
  • Parts 28
  • Time 2h 59m
Horroryas
Ongoing, First published Jan 01, 2018
alteregoegofanfictionmarkfichbachmarkipliermarkiplierfanfictionmaskipliermysterypinkwarfstachewilfordwarfstachexreaderyoutubeyoutubers
BEST READ AT NIGHT

You'll wake up - but you'll never know what happened. 
You'll wake up in somewhere that becomes your new reality...

A reality where a Wilford Warfstache wants you - but most importantly... needs you.

But he will kill you.

Because he's mad.
Public Domain
alteregoegofanfictionmarkfichbachmarkipliermarkiplierfanfictionmaskipliermysterypinkwarfstachewilfordwarfstachexreaderyoutubeyoutubers
Table of contents

28 parts

Sign up to add W̵̬̒ḭ̷́ĺ̷͓f̵̝͋o̷͓͠r̶̭͝d̸̼̍ X READER (ON HOLD) to your library and receive updates
or
#486alterego
Content Guidelines
You may also like
Alters (Markipliers Alter Egos X Reader) ??? by MarksAlterEgos
20 parts Complete
This is a collection of X Readers about the various alter egos of Markiplier (Wilford Warfstache, Darkiplier, Glitchiplier, Googleplier) Thank you all for 20k+ reads and a ranking of 70 in the tag #Markiplier!
Wrong Choice (Darkiplier x Reader) by yukisenpi
21 parts Complete
A date with the man himself, Markiplier, gone completely wrong. Now, you are stuck with the demonic entity Dark who will stop at nothing to make you his and his only. Will you submit? Or will you rebel? started: June 3rd, 2019 finished: February 1st, 2021 #8 in wilford! #16 in wilfordwarfstache! #9 in googleplier! #12 in warfstache! #15 in darkiplierxreader!
A Date With Markiplier by BookGirlPearl
100 parts Complete Mature
You are a huge fan of Markiplier and when you hear he's going to a con in your home town you decide to go meet him. What will happen when you meet?
Life's little bit of Madness~ (Wilford x Criminal Reader Female) by Aubree2004
25 parts Complete Mature
http://www.imgrum.org/media/1579806969932511346_3517530580 If you are the artist of this picture you can have me know if you want this down as the photo. You are a female, who's on the run from the police, but you've been caught. For some odd reason, a Man known as Wilford Warfstache has taken an interest in having an interview with you, and the things you've done. You've killed people on certain occasions, stolen, and you have considered selling off drugs, in which is where Andy comes in. He didn't give you your money, but unlike you he had friends,(Chris and Henry) and now you have more then just police to worry about.
Beneath His Gaze // Darkiplier x Reader by Darkiiplierr
47 parts Complete Mature
(FINISHED!!) ------------------------------------------------------------- You just managed to get out of a very abusive and toxic relationship. Because you lived together with your former boyfriend, you now have no place to stay. Luckily your best friend Markiplier helps you out and lets you move into his house with him. Hoewever, Mark has kept a 'little' secret from you: his alter egos, that you only knew from his YouTube videos, are actually real - and some even live with him. As the big day arrived and you settled into Marks house, it didn't take long before you met them: Wilford Warfstache, Googleiplier, Dr.Iplier, etc... But one in particular stood out - Darkiplier. His piercing gaze followed you, cold yet mesmerizing. At first, he seemed emotionless and withdrawn, but there was an unsettling allure about him that captivated you. Despite his reputation for being eerie and manipulative, you couldn't shake the feeling of fascination and even attraction. The more time you spend with him, the more you found yourself being under a spell of his dark yet sophisticated and charming presence, standing on the edge of an abyss, unsure if you should step back or dive in deeper...
The Dark Mark (Mark/Dark/Wilford/Google x Reader) by Anoniplier
29 parts Complete
(Markiplier x Reader) A meet and greet, and a vulnerable, tired mind. You've realised your dream of meeting Mark, but do you get a little more than you bargained for? And will you be safe when you work out exactly what he's done?
Darkiplier X Wilford (#Darkstache) by Darkiplier_Wilford_
20 parts Complete Mature
Do you ship Darkiplier and Wilford Warfstache? Well if you do then this is the story for you! Enjoy! This story is based on 2 alter egos of the Youtuber Markiplier. Darkiplier his evil alter ego. And Wilford his crazy alter ego. This is my first story and i really hope you like it! I am sorry in advanced if its not that good. "The past is my future. I'll never change" ~Dark
Past Lives (Dark/Damien x Reader) by keeerio
37 parts Complete
highest ranking #1 in markiplier & darkiplier; - "Do you not recognize me, my love? I've missed you so badly," He whispered into her ear, his hands gingerly grazing her exposed arms. "W-Who are you? (Y/n) asked, taking a step away from him. His chuckle echoed in her mind, sending chills down the girl's spine. "My dear, don't shy away from me. You don't want this to end like it did last time, do you? ; a who killed markiplier fanfic
(X) Warfstache's Apprentice [Wilford Warfstache x Reader] (X) by MajorWeirdo666
57 parts Complete Mature
A young journalist gets the chance of a lifetime and becomes apprentice to world renowned reporter, Wilford Warfstache.
Don't Be Cruel [Darkiplier/Markiplier x Reader] by Actual_Angel
24 parts Complete Mature
Mark has been missing for weeks by the time you're visited by Darkiplier - master manipulator/part time murderer. Initially, Dark seems charming and kind on your date with him, but as soon as he kidnaps you, his facade crumbles into something much more sinister. Will Mark come to rescue you or will Dark control you forever? Is Dark truly a monster? Who will you choose? (There may or may not be a hint of Wilford Warfstache. I guess you'll have to read to find out *wink wonk*).
You may also like
Slide 1 of 10
Alters (Markipliers Alter Egos X Reader) ??? cover
Wrong Choice (Darkiplier x Reader) cover
A Date With Markiplier cover
Life's little bit of Madness~ (Wilford x Criminal Reader Female) cover
Beneath His Gaze // Darkiplier x Reader cover
The Dark Mark (Mark/Dark/Wilford/Google x Reader) cover
Darkiplier X Wilford (#Darkstache) cover
Past Lives (Dark/Damien x Reader) cover
(X) Warfstache's Apprentice [Wilford Warfstache x Reader] (X) cover
Don't Be Cruel [Darkiplier/Markiplier x Reader] cover

Alters (Markipliers Alter Egos X Reader) ???

20 parts Complete

This is a collection of X Readers about the various alter egos of Markiplier (Wilford Warfstache, Darkiplier, Glitchiplier, Googleplier) Thank you all for 20k+ reads and a ranking of 70 in the tag #Markiplier!

More details