Of Caverns and Casters [First Publishing]
avadel
  • Reads 12,584
  • Votes 276
  • Parts 3
  • Time <5 mins
  • Reads 12,584
  • Votes 276
  • Parts 3
  • Time <5 mins
avadel
Ongoing, First published Jul 09, 2018
adventurearcanepunkcavecleanpaddangerfantasyfeaturedfirstpersonjourneykingdommagicmultiplepovplagueprinceromancesciencescience-science-fantasyscientiststeampunkteenundergroundwinterwizardyoungadult
[FEATURED BY @YAFantasy]
One run-away prince, two die-hard scientists, magic that may-or-may-not be real, and a land that wasn't supposed to exist. 

Welcome to Avadel.

* * *

Researchers Leavi Riveirre and Sean Rahkifellar want nothing more than to study how the cogs of the universe click together. When a plague unleashes inside their underground city, though, no amount of science can stop it. Determined not to be among the rising count of corpses, they flee. However, surviving topside will require more than just facing the brutal winter. If they want to make it, they'll have to relearn every fact they ever thought they knew.

Prince Aster Jacques is destined to lead all the magicians of Morineaux. But no matter how many tomes he reads or how many times he practices to exhaustion, he remains a poor excuse for a wizard. Desperate to be the magician his country needs, he's willing to do whatever it takes-even if that means abandoning his kingdom to follow a mysterious note to a foreign one.

When these three's paths twist together, they must learn to trust each other if they want any chance at a future. 

*~AWARDS~*
1st Overall
   - The Monthly Gemstone Awards
   - LIGHTNING ROUNDS
   - Wand Awards
  
1st in Fantasy 
  - Piggyback Summer 2019
  - Writers' Choice 2019
  - The Black Cat 2019
  - Winter Rose 2019
  - The Life Elements
  - 2020 Punk Rock
  - The Privus 2020
  - The Holiday
  - ILoveAwards
  - ECAwards

1st in Action/Adventure 
  - Black and Gold Leaf 2019
  - World of Champions 2
  - The Court of Miracles
  - The Sass 2019

1st in Adventure
  - Fallen Angel 2018
  - The Midnight
  - The Peacock

1st in Grammar/Spelling - Bedtime Stories Summer 2019
1st in Action - The Flavored 2019


*~CREDIT~*
Much thanks to @lionobsession, @katianaelyse, @DeltaTangoEthan, @IWJKeller, and @WriterKellie for editing.
Beautiful gif banners made by @Lazybrew
All Rights Reserved
adventurearcanepunkcavecleanpaddangerfantasyfeaturedfirstpersonjourneykingdommagicmultiplepovplagueprinceromancesciencescience-science-fantasyscientiststeampunkteenundergroundwinterwizardyoungadult
Table of contents

3 parts

Sign up to add Of Caverns and Casters [First Publishing] to your library and receive updates
or
#83science-
Content Guidelines
You may also like
Of Whispers and Daggers ✓ [TLRQ #2] by avadel
109 parts Complete
| 𝐖𝐚𝐭𝐭𝐲𝐬 𝟐𝟎𝟐𝟐 𝐒𝐡𝐨𝐫𝐭𝐥𝐢𝐬𝐭𝐞𝐝 • 𝐀𝐦𝐛𝐲𝐬 𝟐𝟎𝟐𝟒 𝐖𝐢𝐧𝐧𝐞𝐫 | RUTHLESS POLITICS Aster Jacques' predecessor is dead, his capital ruined, and his people struggling to fight back against their most hated enemy. Determined to save the country he loves, he prepares to take the throne he fears. Upon returning home, though, the Ladies of the court connive to make him more puppet than prince. DEADLY SECRETS As he fights to untangle their web of lies, he finds a far more frightening truth-someone in the castle hides a traitorous secret. Unsure who to trust, he swears to forge his path alone. But when a vengeful witch offers him a deal and the girl he cares for tangles herself into the danger, he'll be forced to befriend darknesses he'd rather run from than face. A LAND THAT WAS SUPPOSED TO BE UNCONQUERABLE From within and without, Aster's world teeters on the brink of collapse. When lies, love, and war collide, even magic won't be enough to save everyone. WELCOME TO MORINEAUX ~*~ Book 2 of the Lost Roads Quartet. See Of Caverns and Casters for Book 1. Published on Amazon. Cover Art © 2021 Avadel Ink Animated Banners by @Lazybrew
The Ostler's Boy (The Ostler's Boy Book 1) by meganalexandria
3 parts Complete Mature
2023 December Book of the Month @CupidOnTour @WattpadSeries General Fiction Feature JUNE 2023 @HistoricalFiction 'Rise of Civilization' Reading List JUNE 2023 @TheWattys Shortlist 2021 @HistoricalFiction Top 10 of 22 For Historical Fiction Awards @HistoricalFiction Top 25 of 2022 For Historical Fiction Awards #RomanceAwards2022 Shortlister! ----- Love. Duty. Valor. Court & Class. A pseudo medieval romance through the eyes of a reluctant queen. ----- After nearly decades of war, the Oreia and Chalke Empires have forged peace through a political union. And Svana, heir apparent, and driven by Duty, has accepted Fate. Sam; marriage. But like any true newly-adult, and naive young woman, she immediately gets herself into trouble. A simple trip to meet her betrothed blossoms into a forbidden romance that leaves her dreaming, hoping, and wanting for the elusive memory of her childhood; her soulmate. If fate, class disparity and danger is your game, you'll find solace in this dark, broody romance: The Ostler's Boy. READER DISCRETION IS ADVISED. @WattpadHistoricalRomance 's 'Medieval' Reading List DECEMBER 2021 @HistoricalFiction 's 'Medieval' Reading List NOVEMBER 2021 @WattpadDarkFantasy 's 'A Kingdom in Shadows' Reading List OCTOBER 2021 #1 in #historicalfiction DECEMBER 2022 #1 in #KnightInShiningArmor NOVEMBER 2022 #1 in #LifeAndDeath NOVEMBER 2022 #2 in #Swordfighting NOVEMBER 2021 #2 in #fire NOVEMBER 2021 #6 in #sexsecenes NOVEMBER 2021 #2 in #KingsandQueens OCTOBER 2022 #23 in #Romance OCTOBER 2021 #1 in #Medieval OCTOBER 2021 #2 in #darklove NOVEMBER 2021 #1 in #darkacademia DECEMBER 2022 #3 in #knightinshiningarmor FEBRUARY 2024
Beyond the Veil of Yonder (Book 1) by XannaLurel
85 parts Ongoing Mature
If you love the epic worldbuilding of 𝘓𝘖𝘛𝘙, the dark intrigue of 𝘎𝘢𝘮𝘦 𝘰𝘧 𝘛𝘩𝘳𝘰𝘯𝘦𝘴, the monster-hunting grit of 𝘛𝘩𝘦 𝘞𝘪𝘵𝘤𝘩𝘦𝘳, and the soul-deep romance of 𝘖𝘶𝘵𝘭𝘢𝘯𝘥𝘦𝘳, then this story is for you. --------------------------------- He's a battle-hardened knight; she's from the modern world. He survived horrors; she was shielded from them. His body and soul bear scars, but she still believes in wonders. He seeks redemption and peace, and she craves true love. Forgotten forests, cursed kingdoms, and a bond neither of them chose. Together, they must face ancient evils, unravel lost magic, and survive enemies in both shadow and light. Discover if love can truly banish the darkness in this thrilling, emotional tale! ⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎ "Omg... I've never been so invested in a story!" "The story is so captivating and engaging that I couldn't put it down." "The characters are incredibly well-developed!" "It reminds me of Tolkien's lost kingdoms and the mysterious allure of Arthurian and Celtic legends." *********************** 🏆 The Cliffhanger Queen by The Hidden Gem Awards 2024 ************************ 💎 FEATURED ON: @WackyWriters - "Our Judges' Favorites" @Romance - "Slow Burn" and "The Para-Romantasy Experience" @Fantasy - "Dark Fantasy" and "Serialized Spotlight" @highfantasy - "Fair Verona - Romantic Fantasy" @Ambassadors - "Para-Romantasy" @DaturaCommunity - "The Lavender | Fantasy" *********************** Highest Rankings: 🌟 #1 in Dark Fantasy Romance - 13/10/2024 🌟 #1 in War Drama - 16/10/2024 🌟 #1 in Medieval Fantasy - 14/03/2025 🌟 #2 in Portal Fantasy - 05/11/2024 🌟 #3 in Medieval - 02/12/2024 🌟 #4 in High Fantasy - 05/08/2024 🌟 #4 in Empowerment
Raven and Rue // Lindensea 1 by ella_rowan
36 parts Complete
𝗔 𝗯𝗼𝘆 𝘄𝗵𝗼 𝗰𝗮𝗻 𝘁𝗮𝗹𝗸 𝘁𝗼 𝗮𝗻𝗶𝗺𝗮𝗹𝘀. 𝗔 𝗺𝘆𝘀𝘁𝗲𝗿𝗶𝗼𝘂𝘀 𝘆𝗼𝘂𝗻𝗴 𝗺𝗮𝗻 𝘄𝗶𝘁𝗵 𝗮 𝘀𝘁𝗿𝗮𝗻𝗴𝗲 𝗻𝗮𝗺𝗲 𝗮𝗻𝗱 𝗺𝗲𝘀𝘀𝘆 𝗵𝗮𝗶𝗿. 𝗔𝗻 𝗶𝗻𝗱𝗼𝗺𝗶𝘁𝗮𝗯𝗹𝗲 𝗼𝗹𝗱 𝘄𝗼𝗺𝗮𝗻. 𝗔 𝘀𝗮𝗿𝗰𝗮𝘀𝘁𝗶𝗰 𝗺𝗮𝗴𝗶𝗰𝗶𝗮𝗻. 𝗔 𝗰𝗮𝘀𝘁𝗹𝗲, 𝗮𝗻 𝗶𝗻𝘃𝗶𝘁𝗮𝘁𝗶𝗼𝗻 𝘁𝗼 𝘁𝗵𝗲 𝗯𝗮𝗹𝗹, 𝘁𝗵𝗲 𝗰𝗹𝗼𝗰𝗸 𝘀𝘁𝗿𝗶𝗸𝗶𝗻𝗴 𝗺𝗶𝗱𝗻𝗶𝗴𝗵𝘁, 𝗮 𝗹𝗼𝘀𝘁 𝘀𝗵𝗼𝗲 ... 𝗦𝗼𝘂𝗻𝗱 𝗳𝗮𝗺𝗶𝗹𝗶𝗮𝗿 𝘆𝗲𝘁? Pip is the happiest boy in the kingdom of Lindensea, until he loses everything and becomes the saddest boy in the world. Falling in love with a dishevelled young nobleman who is leaving the kingdom seems like a piece of foolishness that will only break his heart. It took hard work and determination for Pip to survive. It will take time, luck, and a sprinkle of magic for a chance at true happiness. But are the stars on his side, or working against him? The question remains: 𝘞𝘩𝘰 𝘪𝘴 𝘙𝘢𝘷𝘦𝘯? 𝘈𝘯𝘥 𝘸𝘩𝘰 𝘪𝘴 𝘙𝘶𝘦? AWARDS 🏆 Winner in Fantasy - Celestia Cove Awards 2024 🏆Winning Finalist in Fantasy - NanoWatt Awards 2023 🎗️ Semi Finalist - Rose Gold Awards 2023 ✨Shortlisted in Fantasy - Amby Awards 2023 27 Major Prizes FEATURES 📖 Newly Written Books - All the Places We Will Go 28/03/2023 📖 Retold - Fractured Fairytales 11/05/2023 📖Magic - Fantasy and Other Worlds (19/10/2023) 📖 TCR Reads - Secret Identities (02/02/2024) 📖 The Reading Room - Feast on Fiction (02/04/2024) 29x Featured Cover design by @AnnamitaMuscaria
uninvited by ShawMcKnight
66 parts Complete
Is the end of the world near? The answer to that might be closer than we thought. One thing is for sure, the world as we knew it is gone. We thought we were alone in the universe. We were wrong. They came uninvited. I certainly didn't invite him into my life. His kind are lifeless with no emotions to speak of. He's incapable of offering any true feelings so why can't I look away from him? How is it that I know whenever he walks into a room? Should we take the lifeline they offer? Are they the enemy or can we trust them? They have the power to save us or destroy us. He has power to save me or destroy me. Winner of the Year in The Miracle Awards 2017 The Grand Winner of The Golden Star Awards 2018 1ST PLACE in TeenFiction 2017 Freedom Awards 1st PLACE in TeenFiction The Proximity Awards 1st Place in TeenFiction The Sanguine Awards 1st Place in TeenFiction The Rose Awards 1st Place Teen Fiction in The Lion Awards 1st Place in Science Fiction The Wolf Awards 1st Place in TeenFiction The Golden Awards Winner in TeenFiction WOW Awards NewComer Award in the Miracle Awards Master Planner Award in The Profound Awards 2nd Place in Romance The Glow Awards 2nd Place in TeenFiction Blue Rose Awards 2nd Place Gray Awards 2nd Place in TeenFiction The Rebellion Awards 2017 2nd Place in the Hidden Gem Awards in TeenFiction 2nd Place in Teen Fiction the Fallen Angel awards 2nd Place in Teen Fiction The Penguin Awards 3rd Place in Science Fiction Corona Awards 3rd Place in the Fallen Angel Awards in Science Fiction 3rd Place Unknown Books in the Blue Rose Awards 3rd Place in The Profound Awards 3rd Place in TeenFiction The Chaos Awards Best Summary The Melancholy Awards Winner of The Story that Kept you Hooked till the End
The Chronicles Of The Council #1: The Sun's Tears by ZoekieS
74 parts Complete
The parallel lives of two princesses living a millennium apart are bound together in the most unlikely of ways. Princess Aebbé of Ardam, haunted by memories of a flash of lightning and burning flesh, returns to her home amidst a seemingly hopeless war. But all is not as it seems in Raven's Peak, and the greatest danger to Ardamland may be from within. More than a millennium later Laelia Darkwood, princess of the elves, feels that she doesn't truly belong in ArBrae Forest. Her fears are solidified by a series of events that would challenge the foundations of her understanding of who she is. Khairrim Cadeyrn, the Second of the Council, protects countless secrets. As Lord of Water and Elves, he knows what happened to the dragons, what lead to the murder of the Seventh of the Council, and the dark secrets behind King Ardam's successful conquests. However, his biggest secret is the one his family, The Council, and Ligtland must never discover. How do events more than a millennium apart tie together? Why does no-one know why Aebbé of Ardam was cursed? Will Laelia unravel the mystery of the loss that is evident in Khairrim's blue eyes? *** Sometimes in order to find your path you have to get lost; sometimes you need to build the path; and sometimes your path is destined to lead you to places and people you never knew you lost. *** The Chronicles of the Council - Book 1 *** Highest rankings: 13 in #fantasy 10 April 2019 9 in #fantasy 6 July 2019 20 in #highfantasy 6 July 2019 16 in #fantasyadventure 6 July 2019 Featured on Wattpad's High Fantasy reading list Winner of The Disco Awards 2019
Solivagant by dreams_of_silver
45 parts Complete
Magic is to be feared. It is a wild, unpredictable thing, and anywhere it goes it brings mayhem and destruction. Those that wield it are even more dangerous. At least, that's what King Soren claimed when he hunted down and killed nearly every magic-user in Eldernia. The only ones he spared were sworn into Soren's service as elite agents that have one purpose, and one purpose only--find any remaining magic-users and give them a choice. Join the Valkir . . . or die. Asher, a sixteen-year-old boy, has managed to conceal his power for years. But when his secret is revealed, there will be no more hiding. || Winner of the 2020 Sinne Awards || || Third place in the 2020 Black and Gold Flames Awards - Fantasy || The fabulous cover is from @-designdistrict ! NOTE: This book is NOT public domain, whatever Wattpad says. All rights are reserved.
COF 4: The Abject Throne by Exequinne
72 parts Complete
FOURTH BOOK OF THE CHRONICLES OF FANTASILIA SERIES 𝘈 𝘴𝘵𝘳𝘪𝘤𝘬𝘦𝘯 𝘴𝘰𝘶𝘭. 𝘈 𝘣𝘶𝘳𝘪𝘦𝘥 𝘵𝘩𝘳𝘰𝘯𝘦. 𝘈 𝘥𝘦𝘴𝘱𝘦𝘳𝘢𝘵𝘦 𝘲𝘶𝘦𝘴𝘵. 𝘈 𝘤𝘩𝘰𝘪𝘤𝘦 𝘵𝘰 𝘮𝘢𝘬𝘦. Xanthiene Vivenca, a fairy with a bounty for her soul, is caught between saving the island or saving herself. With the chaos reigning in the wake of the Imperial Palace's fall, the weight of her friends' betrayals and lies on her shoulders, and the inevitable death of someone she loved, she must sift through the island for a promise of changing her destiny. Nyxis Helgase, a boy with nowhere left to go, is stuck between his friends and his emotions. With the imminent attack in the Nature Fairy territory, the anger clouding his judgment, and a duty he can't deny of a friend, he faces a choice to either save his friends or doom them forever. Reeca Torlin, a disgraced heir, is torn between walking the path to victory and absolving her guilt. With two hidden bases to infiltrate, two mighty leaders to sneak past, and the knowledge of the real power they sought to defeat, she confronts a choice promising salvation on one hand and destruction on the other. Two more kingdoms are bound to fall with the Virtakios distracted. Cardovia is reckless. Synketros has no patience left. The choices are laid out. They only had to choose right, and decide if it's for their sake or the world's. ˜"°•.˜"°•˜"°•.˜"°•˜"°•.˜"°• © 2020 (First Edition) © 2021 (Second Edition) [110,000 - 120,000 words] [Cover by @Moxartx ; Text & Graphics by @Exequinne]
Awakening - The Last Science #1 by Etzoli
143 parts Complete
No one ever knows the whole story... Nestled deep in the forests of the Pacific Northwest, something is emerging. Kept in absolute secrecy, it seeps into a fading town, quietly shared from person to person. For Alden Bensen, a directionless high school graduate, this discovery could mean an escape from his empty existence. To Rachel DuValle, perpetually underestimated and dismissed by the world, magic represents a chance to become something much greater than herself. In the face of an unsuspecting world, their decisions shape the growth of a budding society discovering untold power. This potent force offers anyone the power to change humanity forever - or send it cascading into swift and total annihilation. ----- The Last Science is an ongoing science-fiction / low-fantasy web novel series. New chapters will be posted on Fridays for as long as it takes to tell the whole story. For Wattpad only, chapters are split up by individual scenes-if you would prefer the whole chapters in single pieces, please visit my homepage or another site where I post this story, thanks! Discord: https://discord.gg/5NYk6za Patreon: https://patreon.com/etzoli Content Warning (by request): This series delves into some topics and situations which may be upsetting for some readers. In American rating parlance, the narrative would be rated PG-13 (except for language), but some have noted the story can get pretty dark on occasion. Please use your best judgment, and don't be afraid to take breaks and come back later. I'll still be here! This story will also be published weekly at my website (https://etzo.li). There will be no differences in content, but slight differences in formatting. Feel free to read at whichever site or app you prefer. If you're enjoying the story, consider dropping me a vote over on Top Web Fiction, or come say hi on Discord. Thanks! Discord: https://discord.gg/5NYk6za Patreon: https://patreon.com/etzoli
Sienna and The Heart Of Aislei by CheshireVibes
34 parts Complete Mature
A Fairytale Princess who has a penchant for getting into trouble. A Steampunk Inventor with a keen mind and mysterious origin. What will happen when their fate collides? Princess Sienna is one of the twelve daughters of the King of Alderias. On the eve of her coming-of-age, she meets the foreign inventor, Tallis Gray, who holds many secrets. Together, they encounter dark conspiracies and a deadly quest from a desperate gnome. Read this thrilling adventure and the beginnings of a fantastical love story! COMPLETED ROMANTIC FANTASY/ADVENTURE NOVEL ******************* INSPIRED BY the Fairytale of The Twelve Dancing Princesses This book is just book one in a planned trilogy. It would be classified as a slow burn romance. Mature content warning: This book is only rated mature for mild cursing, violence, and threats of sexual assault. This book will stay in accordance with Wattpad rules. Feedback always welcome :) "This is really good! I've been voting before I read cause I know it will be amazing! Keep working hard 💗" - @Pink_BlossomGirl "I love how deeply you've developed these two characters and the connection between them. It is cute and also realistic that now Sienna is picking up on specific mannerisms from Tallis. I'm honestly rooting for them to form a romantic attachment." @JBryan_mmg "These are such immersive descriptions! Makes me become one with the character." @Sapphire_Winters_289 **************** #94 in Growing up🥳(10/12/2020) #12 in sisterhood💝 (10/15/19) #4 in gnomes and ogres 🧟‍♂️ #5 in rescuing 👸🏽(10/27/2020) #3 in RomanticFantasy 💑(11/30/2020) #102 in sassy 👄 (05/27/2021) +++++++++++++
You may also like
Slide 1 of 10
Of Whispers and Daggers ✓ [TLRQ #2] cover
The Ostler's Boy (The Ostler's Boy Book 1) cover
Beyond the Veil of Yonder (Book 1) cover
Raven and Rue // Lindensea 1 cover
uninvited cover
The Chronicles Of The Council #1: The Sun's Tears cover
Solivagant cover
COF 4: The Abject Throne cover
Awakening - The Last Science #1 cover
Sienna and The Heart Of Aislei cover

Of Whispers and Daggers ✓ [TLRQ #2]

109 parts Complete

| 𝐖𝐚𝐭𝐭𝐲𝐬 𝟐𝟎𝟐𝟐 𝐒𝐡𝐨𝐫𝐭𝐥𝐢𝐬𝐭𝐞𝐝 • 𝐀𝐦𝐛𝐲𝐬 𝟐𝟎𝟐𝟒 𝐖𝐢𝐧𝐧𝐞𝐫 | RUTHLESS POLITICS Aster Jacques' predecessor is dead, his capital ruined, and his people struggling to fight back against their most hated enemy. Determined to save the country he loves, he prepares to take the throne he fears. Upon returning home, though, the Ladies of the court connive to make him more puppet than prince. DEADLY SECRETS As he fights to untangle their web of lies, he finds a far more frightening truth-someone in the castle hides a traitorous secret. Unsure who to trust, he swears to forge his path alone. But when a vengeful witch offers him a deal and the girl he cares for tangles herself into the danger, he'll be forced to befriend darknesses he'd rather run from than face. A LAND THAT WAS SUPPOSED TO BE UNCONQUERABLE From within and without, Aster's world teeters on the brink of collapse. When lies, love, and war collide, even magic won't be enough to save everyone. WELCOME TO MORINEAUX ~*~ Book 2 of the Lost Roads Quartet. See Of Caverns and Casters for Book 1. Published on Amazon. Cover Art © 2021 Avadel Ink Animated Banners by @Lazybrew

More details