•  
    • Browse
    • Paid Stories
    • Editor's Picks
    • The Wattys
    • Adventure
    • Contemporary Lit
    • Diverse Lit
    • Fanfiction
    • Fantasy
    • Historical Fiction
    • Horror
    • Humor
    • LGBTQ+
    • Mystery
    • New Adult
    • Non-Fiction
    • Paranormal
    • Poetry
    • Romance
    • Science Fiction
    • Short Story
    • Teen Fiction
    • Thriller
    • Werewolf
    • Wattpad Picks
    • Editors' Choice
    • From our Stars
    • Wattpad Studios Hits
    • Where LGBTQIA+ stories live 🌈
    • Oh hi, sweet teen stories
    • Your daily thriller dose
    • The Watty Awards
    • Community Happenings
    • Wattpad Ambassadors
      • Create a new storyCreate a new story
      • My Stories
      • Helpful writer resources
      • Wattpad programs & opportunities
      • Writing contests
    Try Premium
    Log in Sign Up
    The True Mistress Has A Thousand Hidden Identities (1)
    The True Mistress Has A Thousand Hi...
    MingzuMing
    • Reads
      Reads 52,243
      52,24352.2K
    • Votes
      Votes 601
      601601
    • Parts
      Parts 200
      200200
    • Time
      Time 11h 5m
      11 hours, 5 minutes11h 5m
    Start reading
    • Reads
      Reads 52,243
      52,24352.2K
    • Votes
      Votes 601
      601601
    • Parts
      Parts 200
      200200
    • Time
      Time 11h 5m
      11 hours, 5 minutes11h 5m
    MingzuMing
    Ongoing
    Ongoing, First published Dec 26, 2021
    1-200
        
        [Almighty A slacking wild heroine vs. Mensao overbearing brain-loving vinegar spirit hero]
        
        [1v1 double knot, face abuse, scumbag, madly off the waistcoat. 】
        
        Because of the wrong hold at birth, Yunci and another girl changed their lives.
        
        Eighteen years later, he recognized his ancestors and returned to the clan, from a wild girl in the country to a real daughter in the capital.
        
        however...
        
        Parents favor fake daughters.
        
        "Aci, Fei Yue is clever, clever and obedient, a thousand times better than you."
        
        The elder brother is kidding the fake sister.
        
        "Yunci! Don't bully Fei Yue, Fei Yue has a simple mind, unlike you, full of bad water!"
        
        It is said that she is unlearned and skillful, has counted down grades, and loves to fight and fights. Everyone looks down on her.
        
        There was only one man who said domineeringly: "I spoil you."
        
        Until one day... the vest was stripped...
        
        Vice President of the Olympic Mathematical Association, e-sports great god, hidden world doctor, master of Chinese painting, queen of music, and leader of the League of Death Gods.
        
        It's all her? !
        
        Everyone worshipped: You are a real boss!
        
        For a time, there are countless pursuers.
        
        The director asked her to make a movie, and the next day, the director was blocked by the entire network.
        
        The King of Singer invited her to dinner, and the next day, the King of Singer was No. 1 in the black material search.
        
        The chaebol gave her a big diamond ring with pigeon eggs. The next day, the chaebol went bankrupt and became a beggar.
        
        A certain vinegar spirit declared its sovereignty on the entire network.
        
        @Yunci: Thank you, my wife.
        
        Alternate Title:真千金她有千层马甲
        Status:Completed
        Author:Mu Xue listens to poems
        Genre:Romance
    All Rights Reserved
    • amnesia
    • beautifulfemalelead
    • complexfamily
    • depictionsofcruelty
    • familyconflict
    • femaleprotagonist
    • geniusprotagonist
    • handsomemalelead
    • hiddenabilities
    • hidingtrueidentity
    • multipleidentities
    • powercouple
    • relationships
    • timetravel
    • tragicpast
    • wealthycharacters
    amnesiabeautifulfemaleleadcomplexfamilydepictionsofcrueltyfamilyconflictfemaleprotagonistgeniusprotagonisthandsomemaleleadhiddenabilitieshidingtrueidentitymultipleidentitiespowercouplerelationshipstimetraveltragicpastwealthycharacters
    Table of contentsLast updated May 19
    • Chapter 1: She is the real daughter
    • Chapter 2: Fiancé has a brain disease
    • Chapter 3: He hates Yunci
    • Chapter 4: Stupid, why would you argue with her?
    • Chapter 5: She lost her first kiss
    • Chapter 6: So tugging?
    • Chapter 7: expected of her sister-in-law, she has a temper!
    • Chapter 8: We want to see you
    • Chapter 9: Put away the scenes of you wanting to get caught
    • Chapter 10: Mom, you're cruel to me tor her...
    • Chapter 11: I'm a natural rebellious person
    • Chapter 12: Murdered with a knife
    • Chapter 13: Are you sure you want to drink with me?
    • Chapter 14: You are the eldest sister
    • Chapter 15: Little thing, your mouth is very spicy
    • Chapter 16: You dare to move her?
    • Chapter 17: Too simpleand boring
    • Chapter 18: A mouse shit, a pot of porridge broke
    • Chapters 19: Catch the small handle
    • Chapter 20: Full score because of cheating
    • Chapter 21: Sister-in-law will be expelled from school!
    • Chapter 22: You are not qualified to talk to me
    • Chapter 23: Vice President of International Olympiad
    • Chapter 24: Shoot yourself in the foot
    • Chapter 25: Cloud guardian
    • Chapter 26: She is more cuter than Yunci
    • Chapter 27: Miss Mansi
    • Chapter 28: Plagiarism
    • Chapter 29: Why just ask me alone!
    • Chapter 30: New Student
    • Chapter 31: Where are her eyes?
    • Chapter 32: Gu worms can kill people invisibly
    • Chapter 33: Life and Death Gu
    • Chapter 34: Life hanging by a thread
    • Chapter 35: Very much like someone I know
    • Chapter 36: Little thing crying nose
    • Chapter 37: I bought it for 300 Million
    • Chapter 38: Worse than Cinderella
    • Chapter 39: Little Overlord
    • Chapter 40: You hand in a blank paper, I will give a zero
    • Chapter 41: There will always be only one granddaughter in my place
    • Chapter 42: Do not eat soft or hard
    • Chapter 43: Someone is following her
    • Chapter 44: Your face is so red
    • Chapter 45: Hidden Physician
    • Chapter 46: What if I have to manage?
    • Chapter 47: Which servant's daughter are you?
    • Chapter 48: This girl makes him very satisfied
    • Chapter 49: its a wild rose
    • Chapter 50: Upset him
    • Chapter 51: Do you need me to accompany you?
    • Chapter 52: Which two classmates are you parents?
    • Chapter 53: He is very upset!
    • Chapter 54: Yunci is playing with guns
    • Chapter 55: First place this year
    • Chapter 56: The face was earned back by Yunci
    • Chapter 57: Classmate Yunci, you are on fire!
    • Chapter 58: Someone is checking you
    • Chapter 59: A piece of rag (slap on the face)
    • Chapter 60: I told you not to touch him!
    • Chapter 61: This is a matter of life.
    • Chapter 62: Bleeding in the body
    • Chapter 63: Is this the hand speed that a person can have?
    • Chapter 64: You didn't wear the dress I gave you?
    • Chapter 65: The little things can't help but be weak
    • Chapter 66: hand of God
    • Chapter 67: Isn't it just a slap?
    • Chapter 68: G
    • Chapter 69: She is a saint and a demon
    • Chapter 70: Take it and brush it
    • Chapter 71: Come to live
    • Chapter 72: Don't let him know
    • Chapter 73: You are hurt?
    • Chapter 74: This girl is pretty tricky
    • Chapter 75: Hell Girl
    • Chapter 76: She was scared to pee
    • Chapter 77: Mr. R
    • Chapter 78: I like my sister
    • Chapter 79: Special medicine
    • Chapter 80: Only for this young master to bully others
    • Chapter 81: Photo of the creator of the gods organization
    • Chapter 82: I want to smash your computer!
    • Chapter 83: Have a mother but no mother!
    • Chapter 84: Swallow once
    • Chapter 85: This is called not getting deceitful
    • Chapter 86: Be aggressive towards a little girl
    • Chapter 87: I see who dares to take her away!
    • Chapter 88: Little things are my baby
    • Chapter 89: Master Che can't eat meat
    • Chapter 90: We all like you
    • Chapter 91: Sister-in-law, don't mess around
    • Chapter 92: We are dead!
    • Chapter 93: Blow his head
    • Chapter 94: Take your life first
    • Chapter 95: We meet tomorrow night
    • Chapter 96: Provoked a big guy
    • Chapter 97: To kowtow to others
    • Chapter 98: You want me not to be held accountable in one sentence?
    • Chapter 99: Join the gods organization
    • Chapter 100: "Her" death day
    • Chapter 101: You try to hook him up?
    • Chapter 102: You close your eyes
    • Chapter 103: meet again
    • Chapter 104: First task
    • Chapter 105: Love came just right
    • Chapter 106: Straight daughter
    • Chapter 107: Teacher Shen, I like you
    • Chapter 108: love at first sight
    • Chapter 109: Is she stealing your man?
    • Chapter 110: Kill two birds with one stone
    • Chapter 111: Master Che, do you remember me?
    • Chapter 112: Unexpected
    • Chapter 113: She wants to accompany me to the dinner
    • Chapter 114: Install, you continue to install
    • Chapter 115: This charity dinner is not easy
    • Chapter 116: Don't get involved with him
    • Chapter 117: Self-digging eyes
    • Chapter 118: Are you afraid that she knows your past?
    • Chapter 119: I didn't beat him
    • Chapter 120: Master Che is sick again
    • Chapter 121: Aci, don't you remember me?
    • Chapter 122: Can you be a little prosperous?
    • Chapter 123: Campus singing competition
    • Chapter 124: Master Che's situation is not so good
    • Chapter 125: I don't raise idlers!
    • Chapter 126: Can't bear to provoke
    • Chapter 127: I sang directly
    • Chapter 128: Yunci is the first place.
    • Chapter 129: I was sold and counted the money for others
    • Chapter 130: Are you abusing him?
    • Chapter 131: My name is Jun Duonuan
    • Chapter 132: I want to sit with classmate Yunci
    • Chapter 133: Yunci is a junior
    • Chapter 134: I'm here to make peace with you
    • Chapter 135: Teacher Shen must teach me well
    • Chapter 136: I didn't steal anything!
    • Chapter 137: Check and monitor
    • Chapter 138: apologize
    • Chapter 139: Just to provoke me
    • Chapter 140: Is getting off work more important than me?
    • Chapter 141: Kid don't interrupt
    • Chapter 142: Copy the works of hometown masters
    • Chapter 143: I am hometown
    • Chapter 144: You just wait to get slapped
    • Chapter 145: She is the hometown of my little apprentice
    • Chapter 146: Why is it crying?
    • Chapter 147: Hypnotized
    • Chapter 148: Are you bent?
    • Chapter 149: Does wearing glasses affect kissing?
    • Chapter 150: Jun Sicher's death report
    • Chapter 151: Help me investigate a person
    • Chapter 152: The reputation of Ruan's family was ruined by you alone!
    • Chapter 153: Protect Ruan Xichen and abandoned her.
    • Chapter 154: Are you threatening us?
    • Chapter 155: The whistleblower is in our class
    • Chapter 156: Crack account
    • Chapter 157: Grace and revenge
    • Chapter 158: Are you trying to force me to death?
    • Chapter 159: Is all this fair to Yunci?
    • Chapter 160: Teacher Shen, I'm chasing you
    • Chapter 161: How could he be You Emperor?
    • Chapter 162: I am the only dog ​​of Aci!
    • Chapter 163: I can be your mother
    • Chapter 164: Your apology is not rare at all
    • Chapter 165: You like me
    • Chapter 166: Secret base
    • Chapter 167: Who is Yixiu?
    • Chapter 168: Join the Go Club
    • Chapter 169: Teacher Shen lost his temper for the first time
    • Chapter 170: You have to coax me
    • Chapter 171: Wrong wrong, wrong again
    • Chapter 172: trap
    • Chapter 173: Wheel war
    • Chapter 174: One to ten
    • Chapter 175: She is your little sister
    • Chapter 176: You get out
    • Chapter 177: I have kissed you
    • Chapter 178: Do you like that Yunci very much?
    • Chapter 179: Grab antibody serum
    • Chapter 180: Melee
    • Chapter 181: I can get you the antidote
    • Chapter 182: Old Poison King
    • Chapter 183: Erase his memory
    • Chapter 184: Master, i was wrong
    • Chapter 185: Elder of the Menglai tribe
    • Chapter 186: He was so good to lie
    • Chapter 187: She remembered
    • Chapter 188: Masked man
    • Chapter 189: Did you admit the wrong person?
    • Chapter 190: Run away
    • Chapter 191: Aci is too simple
    • Chapter 192: Do you really remember nothing?
    • Chapter 193: I can give you freedom
    • Chapter 194: He is a beast
    • Chapter 195: retribution
    • Chapter 196: Don't touch me
    • Chapter 197: Little girl beaten up
    • Chapter 198: Have you ever eaten human flesh?
    • Chapter 199: Welcome to the League of Reapers
    • Chapter 200: I will redeem him

    Get notified when The True Mistress Has A Thousand Hidden Identities (1) is updated

    OR

    If you already have an account,

    By continuing, you agree to Wattpad's Terms of Service and Privacy Policy.
    #30femaleprotagonist
    • Chapter 1: She is the real daughter
    • Chapter 2: Fiancé has a brain disease
    • Chapter 3: He hates Yunci
    • Chapter 4: Stupid, why would you argue with her?
    • Chapter 5: She lost her first kiss
    • Chapter 6: So tugging?
    • Chapter 7: expected of her sister-in-law, she has a temper!
    • Chapter 8: We want to see you
    • Chapter 9: Put away the scenes of you wanting to get caught
    • Chapter 10: Mom, you're cruel to me tor her...
    • Chapter 11: I'm a natural rebellious person
    • Chapter 12: Murdered with a knife
    • Chapter 13: Are you sure you want to drink with me?
    • Chapter 14: You are the eldest sister
    • Chapter 15: Little thing, your mouth is very spicy
    • Chapter 16: You dare to move her?
    • Chapter 17: Too simpleand boring
    • Chapter 18: A mouse shit, a pot of porridge broke
    • Chapters 19: Catch the small handle
    • Chapter 20: Full score because of cheating
    • Chapter 21: Sister-in-law will be expelled from school!
    • Chapter 22: You are not qualified to talk to me
    • Chapter 23: Vice President of International Olympiad
    • Chapter 24: Shoot yourself in the foot
    • Chapter 25: Cloud guardian
    • Chapter 26: She is more cuter than Yunci
    • Chapter 27: Miss Mansi
    • Chapter 28: Plagiarism
    • Chapter 29: Why just ask me alone!
    • Chapter 30: New Student
    • Chapter 31: Where are her eyes?
    • Chapter 32: Gu worms can kill people invisibly
    • Chapter 33: Life and Death Gu
    • Chapter 34: Life hanging by a thread
    • Chapter 35: Very much like someone I know
    • Chapter 36: Little thing crying nose
    • Chapter 37: I bought it for 300 Million
    • Chapter 38: Worse than Cinderella
    • Chapter 39: Little Overlord
    • Chapter 40: You hand in a blank paper, I will give a zero
    • Chapter 41: There will always be only one granddaughter in my place
    • Chapter 42: Do not eat soft or hard
    • Chapter 43: Someone is following her
    • Chapter 44: Your face is so red
    • Chapter 45: Hidden Physician
    • Chapter 46: What if I have to manage?
    • Chapter 47: Which servant's daughter are you?
    • Chapter 48: This girl makes him very satisfied
    • Chapter 49: its a wild rose
    • Chapter 50: Upset him
    • Chapter 51: Do you need me to accompany you?
    • Chapter 52: Which two classmates are you parents?
    • Chapter 53: He is very upset!
    • Chapter 54: Yunci is playing with guns
    • Chapter 55: First place this year
    • Chapter 56: The face was earned back by Yunci
    • Chapter 57: Classmate Yunci, you are on fire!
    • Chapter 58: Someone is checking you
    • Chapter 59: A piece of rag (slap on the face)
    • Chapter 60: I told you not to touch him!
    • Chapter 61: This is a matter of life.
    • Chapter 62: Bleeding in the body
    • Chapter 63: Is this the hand speed that a person can have?
    • Chapter 64: You didn't wear the dress I gave you?
    • Chapter 65: The little things can't help but be weak
    • Chapter 66: hand of God
    • Chapter 67: Isn't it just a slap?
    • Chapter 68: G
    • Chapter 69: She is a saint and a demon
    • Chapter 70: Take it and brush it
    • Chapter 71: Come to live
    • Chapter 72: Don't let him know
    • Chapter 73: You are hurt?
    • Chapter 74: This girl is pretty tricky
    • Chapter 75: Hell Girl
    • Chapter 76: She was scared to pee
    • Chapter 77: Mr. R
    • Chapter 78: I like my sister
    • Chapter 79: Special medicine
    • Chapter 80: Only for this young master to bully others
    • Chapter 81: Photo of the creator of the gods organization
    • Chapter 82: I want to smash your computer!
    • Chapter 83: Have a mother but no mother!
    • Chapter 84: Swallow once
    • Chapter 85: This is called not getting deceitful
    • Chapter 86: Be aggressive towards a little girl
    • Chapter 87: I see who dares to take her away!
    • Chapter 88: Little things are my baby
    • Chapter 89: Master Che can't eat meat
    • Chapter 90: We all like you
    • Chapter 91: Sister-in-law, don't mess around
    • Chapter 92: We are dead!
    • Chapter 93: Blow his head
    • Chapter 94: Take your life first
    • Chapter 95: We meet tomorrow night
    • Chapter 96: Provoked a big guy
    • Chapter 97: To kowtow to others
    • Chapter 98: You want me not to be held accountable in one sentence?
    • Chapter 99: Join the gods organization
    • Chapter 100: "Her" death day
    • Chapter 101: You try to hook him up?
    • Chapter 102: You close your eyes
    • Chapter 103: meet again
    • Chapter 104: First task
    • Chapter 105: Love came just right
    • Chapter 106: Straight daughter
    • Chapter 107: Teacher Shen, I like you
    • Chapter 108: love at first sight
    • Chapter 109: Is she stealing your man?
    • Chapter 110: Kill two birds with one stone
    • Chapter 111: Master Che, do you remember me?
    • Chapter 112: Unexpected
    • Chapter 113: She wants to accompany me to the dinner
    • Chapter 114: Install, you continue to install
    • Chapter 115: This charity dinner is not easy
    • Chapter 116: Don't get involved with him
    • Chapter 117: Self-digging eyes
    • Chapter 118: Are you afraid that she knows your past?
    • Chapter 119: I didn't beat him
    • Chapter 120: Master Che is sick again
    • Chapter 121: Aci, don't you remember me?
    • Chapter 122: Can you be a little prosperous?
    • Chapter 123: Campus singing competition
    • Chapter 124: Master Che's situation is not so good
    • Chapter 125: I don't raise idlers!
    • Chapter 126: Can't bear to provoke
    • Chapter 127: I sang directly
    • Chapter 128: Yunci is the first place.
    • Chapter 129: I was sold and counted the money for others
    • Chapter 130: Are you abusing him?
    • Chapter 131: My name is Jun Duonuan
    • Chapter 132: I want to sit with classmate Yunci
    • Chapter 133: Yunci is a junior
    • Chapter 134: I'm here to make peace with you
    • Chapter 135: Teacher Shen must teach me well
    • Chapter 136: I didn't steal anything!
    • Chapter 137: Check and monitor
    • Chapter 138: apologize
    • Chapter 139: Just to provoke me
    • Chapter 140: Is getting off work more important than me?
    • Chapter 141: Kid don't interrupt
    • Chapter 142: Copy the works of hometown masters
    • Chapter 143: I am hometown
    • Chapter 144: You just wait to get slapped
    • Chapter 145: She is the hometown of my little apprentice
    • Chapter 146: Why is it crying?
    • Chapter 147: Hypnotized
    • Chapter 148: Are you bent?
    • Chapter 149: Does wearing glasses affect kissing?
    • Chapter 150: Jun Sicher's death report
    • Chapter 151: Help me investigate a person
    • Chapter 152: The reputation of Ruan's family was ruined by you alone!
    • Chapter 153: Protect Ruan Xichen and abandoned her.
    • Chapter 154: Are you threatening us?
    • Chapter 155: The whistleblower is in our class
    • Chapter 156: Crack account
    • Chapter 157: Grace and revenge
    • Chapter 158: Are you trying to force me to death?
    • Chapter 159: Is all this fair to Yunci?
    • Chapter 160: Teacher Shen, I'm chasing you
    • Chapter 161: How could he be You Emperor?
    • Chapter 162: I am the only dog ​​of Aci!
    • Chapter 163: I can be your mother
    • Chapter 164: Your apology is not rare at all
    • Chapter 165: You like me
    • Chapter 166: Secret base
    • Chapter 167: Who is Yixiu?
    • Chapter 168: Join the Go Club
    • Chapter 169: Teacher Shen lost his temper for the first time
    • Chapter 170: You have to coax me
    • Chapter 171: Wrong wrong, wrong again
    • Chapter 172: trap
    • Chapter 173: Wheel war
    • Chapter 174: One to ten
    • Chapter 175: She is your little sister
    • Chapter 176: You get out
    • Chapter 177: I have kissed you
    • Chapter 178: Do you like that Yunci very much?
    • Chapter 179: Grab antibody serum
    • Chapter 180: Melee
    • Chapter 181: I can get you the antidote
    • Chapter 182: Old Poison King
    • Chapter 183: Erase his memory
    • Chapter 184: Master, i was wrong
    • Chapter 185: Elder of the Menglai tribe
    • Chapter 186: He was so good to lie
    • Chapter 187: She remembered
    • Chapter 188: Masked man
    • Chapter 189: Did you admit the wrong person?
    • Chapter 190: Run away
    • Chapter 191: Aci is too simple
    • Chapter 192: Do you really remember nothing?
    • Chapter 193: I can give you freedom
    • Chapter 194: He is a beast
    • Chapter 195: retribution
    • Chapter 196: Don't touch me
    • Chapter 197: Little girl beaten up
    • Chapter 198: Have you ever eaten human flesh?
    • Chapter 199: Welcome to the League of Reapers
    • Chapter 200: I will redeem him
    Report this story
    You may also like
    The Disobedient Girl Awakened by BooklessBookworm
    The Disobedient Girl Awakened
    43 parts Complete
    43 parts
    Complete
    Xia Yao's self-awareness awakened and she found out she was only a vicious female character with re...
    ¿Is*President*Lu*Bankrupt*Today? by gulmadosme
    ¿Is*President*Lu*Bankrupt*Today?
    20 parts Ongoing
    20 parts
    Ongoing
    ~ALL CREDITS BELONG TO THE AUTHOR AND TRANSLATOR(S)❤️~ ~ALL CREDITS BELONG TO THE AUTHOR AND TRANSL...
    THE SIDE CHARACTER'S HIDDEN BOSS! by potatochipshiii
    THE SIDE CHARACTER'S HIDDEN BOSS!
    200 parts Ongoing
    200 parts
    Ongoing
    ❝THE SIDE CHARACTER'S HIDDEN BOSS!❞ SUMMARY A 20-year-old genius medical student transmigrated to a...
    Real or Fake Missy : I Have a Piece of Godly Land by takas_mo
    Real or Fake Missy : I Have a Piece of Godly...
    55 parts Complete
    55 parts
    Complete
    COMPLETED For offline reading purposes only. Synopsis The Cheng family finally found the real daug...
    Awakened as a Fine Female Cannon Fodder by ChristenIceDejesus
    Awakened as a Fine Female Cannon Fodder
    93 parts Complete
    93 parts
    Complete
    In every book, there's always a female cannon fodder who seeks death - the ones who are arrogant an...
    Apocalyptic pregnancy MTL by hnd670
    Apocalyptic pregnancy MTL
    76 parts Complete
    76 parts
    Complete
    NOT MY STORY ALL RIGHTS BELONGS TO THE AUTHOR, THIS IS MTL. How does it feel to have a big belly am...
    Wealthy Supporting Actress Tore The Script 豪门女配撕碎了剧本 by rainbowfartfartfart
    Wealthy Supporting Actress Tore The Script 豪...
    95 parts Complete
    95 parts
    Complete
    NOT MY STORY FOR OFFLINE PURPOSES ONLY Jiang Dai had a massive fight with her leading billionaire h...
    BGLBAATIB by potatochipshiii
    BGLBAATIB
    22 parts Ongoing
    22 parts
    Ongoing
    ❝BIGSHOT GET'S LOVED BY ALL AFTER TRANSMIGRATING INTO A BOOK❞ SUMMARY "Jiang Yu transmigrates into...
    I Was Never Yours by JessGirl93
    Paid Stories Badge
    I Was Never Yours
    42 parts Complete
    42 parts
    Complete
    When Arianna marries billionaire Zach Price to save her family, she doesn't expect to fall in love...
    Transmigrated as the Tortured Female Lead's Daughter - Part 2 by Akshita27031999
    Transmigrated as the Tortured Female Lead's...
    173 parts Ongoing
    173 parts
    Ongoing
    Note: for offline purposes only. My mother is the sweet, silly, and innocent protagonist of an angs...
    You may also like
    • The Disobedient Girl Awakened cover
      absentparents
    • ¿Is*President*Lu*Bankrupt*Today? cover
      fantasy
    • THE SIDE CHARACTER'S HIDDEN BOSS! cover
      betrayed
    • Real or Fake Missy : I Have a Piece of Godly Land cover
      chinesenovel
    • Awakened as a Fine Female Cannon Fodder cover
      beautiful
    • Apocalyptic pregnancy MTL cover
      apocalypse
    • Wealthy Supporting Actress Tore The Script 豪门女配撕碎了剧本 cover
      beautifulfemalelead
    • BGLBAATIB cover
      bigshot
    • I Was Never Yours cover
      Paid Stories Badge arranged
    • Transmigrated as the Tortured Female Lead's Daughter - Part 2 cover
      child

    The Disobedient Girl Awakened

    43 parts Complete
    43 parts
    Complete

    Xia Yao's self-awareness awakened and she found out she was only a vicious female character with reduced wisdom created by an author. The heroine of the novel was the gentle, kind, and considerate f...

    Start reading
    • Paid Stories
    • Try Premium
    • Get the App
    • Language
    • Writers
    • |
    • Business
    • Jobs
    • Press
    • Terms
    • Privacy
    • Accessibility
    • Help
    • © 2022 Wattpad