Story cover for WRITTEN IN BLOOD | The Unnatural Brethren | Preview {Unedited} by SilvanaGSanchez
WRITTEN IN BLOOD | The Unnatural Brethren | Preview {Unedited}
SilvanaGSanchez
  • Reads 3,638
  • Votes 233
  • Parts 13
  • Time 1h 19m
  • Reads 3,638
  • Votes 233
  • Parts 13
  • Time 1h 19m
SilvanaGSanchez
Ongoing, First published Mar 16, 2016
bloodcrimedarkromancefangsfictiongothichistoricalhorrorlebookawards2016lesupernaturalmagicmonstersoriginsparanormalromanceroseawardstheveilednightvampirewattpadwattys2016
~ROSE AWARDS WINNER~
    ~LE BOOK AWARDS WINNER ~
    
A treat for historical paranormal romance lovers!

Ivan Lockhart cheated death for the last time.

In seventeenth-century England, Ivan embarks on a trip to the Old World, ready to run away from his sins.
The pleasures of the luxurious Venetian lifestyle numb the guilt that Lockhart carries day by day. But not all is as it seems, and soon Ivan finds himself wrapped in the darkest mysteries of La Serenissima.

Ancient myths come to life and legends rise from their graves, in the first installment of The Unnatural Brethren!


                                           *  *  *  *  *  *  *  *  
      
      
      ° Registered by SafeCreative #1608048536254
      ° Total or partial reproduction is forbidden.
All Rights Reserved
bloodcrimedarkromancefangsfictiongothichistoricalhorrorlebookawards2016lesupernaturalmagicmonstersoriginsparanormalromanceroseawardstheveilednightvampirewattpadwattys2016
Table of contents

13 parts

Sign up to add WRITTEN IN BLOOD | The Unnatural Brethren | Preview {Unedited} to your library and receive updates
or
#422gothic
Content Guidelines
You may also like
Resident Evilove (Lady Alcina Dimitrescu - Resident Evil) by darklordi
28 parts Complete Mature
Following the death of his mother, Mathias Derune, a young French writer, learns from her will, that he inherited a house belonging to the family for generations, and located in the region of Transylvania. Intrigued but also eager to be able to make his mourn, Mathias goes to Transylvania to discover this mysterious heritage. But on his journey to the next small town, an accident occurs and Mathias is the only survivor of the bus. Wandering, wounded, through this mountainous and wild region, Mathias discovers a mysterious isolated village in the middle of the mountains, as well as a huge castle. Hoping to find help there, Mathias will very quickly discover that this place isolated from the rest of the world is in reality the domain of monsters with terrifying powers, called the Four Lords, themselves responding to the orders of a kind of local deity named Mother Miranda. Among these four monstrous lords is Lady Alcina Dimitrescu, great vampiric countess who will then show a certain interest in the young mortal man, eager to keep him to herself. For Mathias, the beginning of a story that will change his life forever, in a way he never could have imagined.
Love, Lies & Immortal Ties - Whitby Shadows Series Book 1 by CJLaurence
30 parts Complete
I moved to Whitby expecting my days to be filled with grief and heartache while I watched my father die. But turns out the town has much more to offer a teenage girl like me. His name is Marcus Davenport. Rich. Powerful. Admired by the locals. Not. Human. If I were smart, I would have run the other way when I realized what he was. But there's this undeniable pull between us, a heartbeat that brings us both to life whenever we're together. I convinced myself it was fate drawing lines in the sand, the beginning of a love story that would end with forever. But I was wrong. Turns out the blood running through my veins is tied to Marcus in a way that corrupts everything we feel for each other. It's no longer something I can trust. Nothing is as it seems. The paranormal residents of Whitby altered my reality forever, and now I'm caught in a web of dark secrets and deadly deceits. The future is more uncertain than it has ever been, and I have no idea what's going to happen between Marcus and me. Oh, and then there's Luke, another one of this town's little secrets...and one huge complication.
Witching Tree (Alice Gray Book 1) by TabbyGoddard
68 parts Complete
New job, new city, fresh start. If she could only ignore the magic, strange creatures and weird family history that plague her every step, Alice Gray 'might' have a chance at a normal life and new boyfriend. Probably not though, normal isn't really her thing. ⭐️⭐️⭐️⭐️⭐️ In the wilds of rural Lancashire, England, in 1612, the members of the famous Pendle Coven were rounded up to be tried and executed. Or so Thomas Potts told the world in his account of the events. But all was not as it seemed. One survived. Her name is Alice Gray. In modern-day England 25 yr old Alice Gray is haunted by strange dreams of a woman like her, but not her. Thrust into a new reality, Alice must find her place into a world where witches and vampires thrive. And if that wasn't enough, they all want something from her... If you like it vote and comment! © 2020 Tabitha Goddard All Rights Reserved Cover art: © 2020 Tabitha Goddard
Haunted Shadows: The Devil's Stone by ChelseaStawicki
18 parts Ongoing Mature
Living in a cruel world is one thing for the young Nicolas Arthur Sharp, after being beaten up in White Oak High School, Nick along with his sister Caitlin Sharp and his Misfit Family starts to mess around one night together, unaware that they are being watched... the little gang of Misfits started to experience paranormal events, but they are just starting... Once the whole thing has actually started, Nick starts to spiral into a thick fog of darkness, his entire world of feeling careless takes a deeper toll on him, to no longer care about anything, not even to himself... By the time Nick discovers a connection with another teenager... Nick is on a voyage to discover what his purpose is in life, the only purpose that he believes is to be nothing... That's when everything changes in the shadows behind his soul, he's not who he thinks he is, as his life becomes darker and cruelty corrupts him entirely, Nick is coming face to face with a monster that doesn't just want his life. Nick holds something far more than an average human soul, possessing a power of pure darkness. Nick must find a way to become what HE truly wants in life, to know what he still cares for and why his life is nothing but darkness...or worse...corrupted. WARNING! This story involves mature language and violence! This story is only suitable for 18+! Viewer Discretion is Advised! All locations, characters and names are purely coincidental, living or dead.
Blessings From Above by Lets_Read_And_Chill
35 parts Ongoing
We often dream about living in a world far different from our own. It's nice to dream about it, after all reality is disappointing. To dream of having magic, being able to soar with dragons in a beautiful green forest. But that's all it is right? A dream.... Yeah. But not for me. I possessed the body of a fake saintess who was going to die when the real saint appeared later on in the story. This world is filled with magic. The history is so rich. But I don't wanna die! I just transported here. I don't wanna die just yet!
Heaven Folds in Love (JohanNorth) SANGUE E MARE (Blood and Sea) by NABATAEANSU
21 parts Ongoing Mature
Not a canon.. North's world shattered the day his closest friend died-a tragedy traced back to the rigid, merciless lineage of Johan Ratchatha. Consumed by hatred, North swears vengeance, but fate is crueler than he imagined. Secrets he didnt know that lied behind his family slowly unvealed. Ancient magic intervenes, binding North and Johan in a blood-woven ritual where their lifelines entwine. Their survival depends on a forbidden rite-one that demands closeness, trust, and the mending of hearts. The deeper they spiral into the magic's grip, the more the lines between love and hate blur. But this bond is a double-edged sword. Blood will spill. Bodies will break. And in a world where pain carves love into flesh, can they survive each other? ⚠ **Warning:** This story delves into intense violence, heartbreak, and searing passion. Prepare for an emotional storm of revenge, obsession, and a love born from the ashes of hatred. Johannorth fic
A Mortal Indiscretion; Author's Cut by Barbraeross
1 part Complete Mature
Justin Bertolli, a 29-year-old free-spirited bachelor with smoldering good looks, had nothing to want for. Until a chance encounter with a woman unlike any other. Ambra Taylor was a stunning natural beauty, full of mystery and sensuality. A woman that made Justin rethink everything he ever wanted. Ambra was perfect, all except for her puzzling behaviors. Justin had questions about Ambra's past that he could not answer. Nothing could prepare him for what Ambra really was. Will his love be strong enough to keep them together, forever? A page turning paranormal romance set in the late 1990's, A Mortal Indiscretion is an epic love story that explores love, life, and death. Join Justin on his journey to learn about Ambra and what she truly is. A Mortal Indiscretion is the first novel in a vampire romance series. Look for the dark, foreboding sequel, Marzio's Revenge, available now in Ebook and Paperbac
Grey III - Revelations by TierneyDanae
50 parts Complete Mature
Some things are stronger where they have been broken, other things shatter with the slightest pressure. Loyalty, secrets, hearts, and souls can do both, but when a war is coming, how do you know where to place your faith? » ✦ « Book III sees the Clan's much-awaited reunion, prophecies realized, bonds and breaks tested, and a new power awakened. Plus, an old acquaintance joins the fray - but as friend or foe? Will everyone make it out alive? (lol. nope) » ✦ « Highest Rankings: #1 in Demonology #2 in Supernatural Romance #4 in Angel Romance #Mature (still) Not a YA novel **It's been a few years break for grad school & a wedding, but I'm back at it again and can't wait to dive into Book III. Thank you all for the support 🖤
Ghost Perfume | ✔ by natalisghosts
45 parts Ongoing Mature
In a world where the dead linger, one girl holds the key to helping them cross over. But Rose's quiet life is shattered when four mysterious brothers arrive with a dark secret. As tensions rise and some ghosts prove more dangerous than others, the brothers only want to keep her safe. Can she trust them, or will the secrets between them be her undoing? And will she ever be able to break through their masks? **COMPLETE** **SEQUEL IS ALSO COMPLETE** My death notebook was out. I surreptitiously slid it into my backpack. He offered me the cards. "Pick a game, Rose?" "Um." They looked at me. "How about cheat?" "Never heard of it," Alexander said, collapsing to sit on the floor with his back to my bed. Gabriel sat cross-legged. "Show us," he said. I knelt to complete the circle, taking out the cards and shuffling them. Alexander snorted and snatched the cards out of my hands to shuffle them himself. "I got it, drunk girl." "I am not," I said, tugging on the cards. My fingers tangled with his. He let them go. I distributed the cards among us, my hair swinging as I leaned forward to give them their share. I tucked it behind my ears. They watched me quietly. I could hear the party outside my room, a muffled shouting beat, but we were safe in my room.
You may also like
Slide 1 of 9
Resident Evilove (Lady Alcina Dimitrescu - Resident Evil) cover
Love, Lies & Immortal Ties - Whitby Shadows Series Book 1 cover
Witching Tree (Alice Gray Book 1) cover
Haunted Shadows: The Devil's Stone cover
Blessings From Above cover
Heaven Folds in Love (JohanNorth) SANGUE E MARE (Blood and Sea) cover
A Mortal Indiscretion; Author's Cut cover
Grey III - Revelations cover
Ghost Perfume | ✔ cover

Resident Evilove (Lady Alcina Dimitrescu - Resident Evil)

28 parts Complete Mature

Following the death of his mother, Mathias Derune, a young French writer, learns from her will, that he inherited a house belonging to the family for generations, and located in the region of Transylvania. Intrigued but also eager to be able to make his mourn, Mathias goes to Transylvania to discover this mysterious heritage. But on his journey to the next small town, an accident occurs and Mathias is the only survivor of the bus. Wandering, wounded, through this mountainous and wild region, Mathias discovers a mysterious isolated village in the middle of the mountains, as well as a huge castle. Hoping to find help there, Mathias will very quickly discover that this place isolated from the rest of the world is in reality the domain of monsters with terrifying powers, called the Four Lords, themselves responding to the orders of a kind of local deity named Mother Miranda. Among these four monstrous lords is Lady Alcina Dimitrescu, great vampiric countess who will then show a certain interest in the young mortal man, eager to keep him to herself. For Mathias, the beginning of a story that will change his life forever, in a way he never could have imagined.

More details