Blonde Jokes.
nataliecw
  • Reads 1,563,657
  • Votes 37,694
  • Parts 62
  • Time 35m
  • Reads 1,563,657
  • Votes 37,694
  • Parts 62
  • Time 35m
nataliecw
Ongoing, First published Feb 07, 2012
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Blonde Jokes :) if you think they're funny, you can tell them to your friends :)
Public Domain
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Table of contents

62 parts

Sign up to add Blonde Jokes. to your library and receive updates
or
#11repair
Content Guidelines
You may also like
Short Stories and Poems by CJ_Pride
32 parts Complete
This is my collection of random short stories and poems that I have written.
Dark at Midnight ~*BOOK ONE*~ by xXdArKbuNNyXx
15 parts Complete
What would you do when you wake up on your birthday to find your parents gone? Midnight didn't know how to react. Men came for her and she listened to her only instincts: run and hide! And that's what she did for the rest of her life. In a town she meets special people and then They come. What does she do when she wants to save the people she cares about? She does what she does best, she runs.
In the Absence of a Good Life by ifindedcake
27 parts Complete
Meet Jimmy. He's the guy with all the problems, the screw up who always acts like a complete and total jerk. The one guy that's forever in trouble. Well, what happens when his habits get him into situations a little more serious than your usual high school jerk's problems? Jimmy's in a hole too deep to climb out of...and he's only digging deeper... (sorry, I suck at summaries...please give it a go...)
The blonde & The bad by lovelycodyfan
31 parts Complete
“Making friends is hard, falling in love is harder but falling in love with two wrong persons is astonishing easy. Still I would have preferred my life simple, no Guy, no Damon, no friends and no worries about people discovering my secrets.” As a typical teenage girl Jamey goes through life with a lot of secrets, some horrible secrets. That is why when she's sent to her first high school to make her senior year the best year, she wants to go by as unnoticed as possible. But as uncaring as the blonde girl is, she has a weakness. Guys. Yes the girl that had never loved a boy before, can only find happiness in unknown territory. Maybe that's the reason why she slowly finds herself falling for bad boy Guy Jackson. Making his way to her virginity, she tries to find shelter with an unexpected third party.
Everyone Needs A Hero.... Even You. A reader x Leonardo by Bit_h_
55 parts Complete
*BANG* I felt a sharp intense pain in my leg. I screamed a blood curdling scream. "THEY SHOT ME IN MY LEG. MY FUCKING LEG!" I screamed to myself. You start a new job at a museum before it's attacked by the purple dragons, they find you hiding and shoot you in your leg. You meet a green mutant trying to save you and the things the purples dragons stole. You weren't stable enough on your own so Leo made a quick decision to take you back to the lair hoping Donnie could help you. Later after You're healed, you learned more about him and his family, you figure out about the Kraang and the Foot Clan. You grow fond of Leo and his family, along with there friends Casey and April and help them on missions when you can. But, you notice Leo always try's to play hero and risks his life saving everyone. You start to fear that Leo playing hero could be the death of him. Worrying of Leos problems there's somthing going on with you. Not only You keep hearing voices and seeing things but, you have to understand the emotions you feel for the blue chad turtle. Can you figure out what's going on with you? Can you help Leo? Or will it be too late? Started on Jan.3 2021 Holly crap 10 reads already?!? 20 reads?!?! And someone added to their library?!?! BRO thank you!! 40 reads and 2 story's omg. This is amazing.! Thank you so much!, 100 flipping reads?!? (School is being hectic as heck so expect new parts every weekend) 200?!? Wtffffff 300. 400?!?! You guys are insane!! 500?"?!"!?! BRUH WTFFFFF❤️❤️❤️ 32k 👁👁 bro what.
Reality by Perscri
67 parts Ongoing Mature
Your attention, please! Before you read any further, consider this your only warning. The truth I'm about to share with you has the power to shatter your perception of reality. If you value your sanity, it's best to dismiss this as just another story-a piece of fiction that happened to land in your lap. Trust me, it's safer that way. I wish I had done the same. I wish I had kept believing the lies. But no... I just had to play detective.
All I Ever Wanted by number1swifty
47 parts Complete
Emma's life was never perfect. She never had the nice house, white picket fence and a beautiful labrador puppy. She never wanted any of that anyway. All she ever wanted was loving parents for her and her sister. She's come to terms with the fact that it's never going to happen. Mike had it even worse. But for him it's in the past and all he wants to do is move on and forget. But it's not as easy as it sounds. Then one day there paths cross in the most unlikley of situations...
Runaway Bride (Editing) by strength0629
44 parts Complete
The night before the wedding Derrick spoke to his fiancé over the phone. They said how much they loved each other and that they would meet at the alter the next day. Both, Derrick and Angela had a few friends over that evening, they stayed in the same hotel but in different rooms. Except the next day Angela was no where in sight. Only leaving a note and her engagement ring behind while everything else was gone. Derrick couldn't understand what went wrong. She didn't explain and with new information from others, telling him how nervous she had been, he knew she had a change of heart and left him. Five years later with no contact from Angela's family or friends, Derrick receives a call from her father, Dave. Dave informs him that the police showed up at his home early this morning and was told to go to the hospital. Angela had been found and now the policemen would like to know why they never officially declared Angela as a missing person? Also, everyone would like to know who is the young girl that is with her? With many years being apart and so many questions, Derrick and Angela are both desperate for answers that can't come fast enough. Derrick is engaged and is to marry Carly in three months. Are Angela's answers going to change Derrick's mind or will it push him further into his relationship? Or are Angela emotions going to get the best of her and refuse to let Derrick back into her life?
My Killer Romance by iguana95
35 parts Complete
Alice was perfectly fine living the highly secretive and cavalier life she had. Honestly, between the exotic locations and to die for gadgets, life couldn't get any better, and she was content thinking she was the only one of her kind. That was until she met him. Ever since that day on the airplane he's been doing nothing but turning her world upside down and then some. That is to say, in a world full of adventure she wasn't expecting this one.
Stupid Cupid Had Me Falling For The Leader Of The Drapes by AmariannaRose
4 parts Complete
**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?
You may also like
Slide 1 of 10
Short Stories and Poems cover
Dark at Midnight ~*BOOK ONE*~ cover
In the Absence of a Good Life cover
The blonde & The bad cover
Everyone Needs A Hero.... Even You. A reader x Leonardo cover
Reality cover
All I Ever Wanted cover
Runaway Bride (Editing) cover
My Killer Romance cover
Stupid Cupid Had Me Falling For The Leader Of The Drapes cover

Short Stories and Poems

32 parts Complete

This is my collection of random short stories and poems that I have written.

More details