Blonde Jokes.
nataliecw
  • Reads 1,563,629
  • Votes 37,694
  • Parts 62
  • Time 35m
  • Reads 1,563,629
  • Votes 37,694
  • Parts 62
  • Time 35m
nataliecw
Ongoing, First published Feb 07, 2012
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Blonde Jokes :) if you think they're funny, you can tell them to your friends :)
Public Domain
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Table of contents

62 parts

Sign up to add Blonde Jokes. to your library and receive updates
or
#38license
Content Guidelines
You may also like
The Three Of Us by 830freckles
33 parts Complete
Ronnie feels as if she doesn't have a family. Ever since she was a child, she's been tossed from foster home to foster home. In every one of them, her foster family doesn't seem to really accept her and she just can't seem to accept them. To her, the possibility of ever being close to someone again seems impossible. Asher is living a fake life. Ever since he was nine years old and found his adoption certificate in his "father's" office, he's been pretending to be his "parent's" son. Nevertheless, he's been dying to tell them forever that he knows that they aren't his real mother and father. As they move from town to town, he realizes that it may be too late to tell them the truth. Avery feels insecure. Ever since the people he used to consider parents announced that he was adopted, he's been feeling nothing but distant and betrayed whenever they're around. However, he only sticks around for the angelic six year old girl that he still considers his little sister: Hartlyn. Three teenagers that have nothing in common besides the fact that they're all adopted meet in one high school. And now... they seem to be closer than ever.
I am the King, Right? by cheesydancer
40 parts Complete
Michael Zanaya was crowned king of Arsom when he was only four. His father recently died of cancer and his mother disappeared when he was little. 13 years later, how can Michael deal with being one of the youngest kings with his Uncle Harold as advisor? What happens when one of his oldest friends comes back to him? This is a modern day monarchy, filled with misconceptions, secret plans and more than one evil plot :D
Runaway Bride (Editing) by strength0629
44 parts Complete
The night before the wedding Derrick spoke to his fiancé over the phone. They said how much they loved each other and that they would meet at the alter the next day. Both, Derrick and Angela had a few friends over that evening, they stayed in the same hotel but in different rooms. Except the next day Angela was no where in sight. Only leaving a note and her engagement ring behind while everything else was gone. Derrick couldn't understand what went wrong. She didn't explain and with new information from others, telling him how nervous she had been, he knew she had a change of heart and left him. Five years later with no contact from Angela's family or friends, Derrick receives a call from her father, Dave. Dave informs him that the police showed up at his home early this morning and was told to go to the hospital. Angela had been found and now the policemen would like to know why they never officially declared Angela as a missing person? Also, everyone would like to know who is the young girl that is with her? With many years being apart and so many questions, Derrick and Angela are both desperate for answers that can't come fast enough. Derrick is engaged and is to marry Carly in three months. Are Angela's answers going to change Derrick's mind or will it push him further into his relationship? Or are Angela emotions going to get the best of her and refuse to let Derrick back into her life?
Merely Lust by annadez
20 parts Complete Mature
One night with Nikolas is all any woman can expect. He is a seducer, a rake, a sexy vampire who promises nothing but one night of utter fulfillment to all of his conquests. Iris gives in to him for one night of hot, passionate, mind-blowing sex but leaves something behind that she plans to recover. However, when she finally finds the illusive Casanova, he has a proposition to make that could put something much more important in danger: her heart.
Stupid Cupid Had Me Falling For The Leader Of The Drapes by AmariannaRose
4 parts Complete
**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?
In the Absence of a Good Life by ifindedcake
27 parts Complete
Meet Jimmy. He's the guy with all the problems, the screw up who always acts like a complete and total jerk. The one guy that's forever in trouble. Well, what happens when his habits get him into situations a little more serious than your usual high school jerk's problems? Jimmy's in a hole too deep to climb out of...and he's only digging deeper... (sorry, I suck at summaries...please give it a go...)
Something Worth Fighting For by preciious-diamondz
47 parts Complete
What would you fight for? Your best friends, the people in your town, perhaps your country, or maybe even a second chance at love?
Reality by Perscri
59 parts Ongoing Mature
Your attention, please! Before you read any further, consider this your only warning. The truth I'm about to share with you has the power to shatter your perception of reality. If you value your sanity, it's best to dismiss this as just another story-a piece of fiction that happened to land in your lap. Trust me, it's safer that way. I wish I had done the same. I wish I had kept believing the lies. But no... I just had to play detective.
Why do I love you? (COMPLETED!!! In editing process) by chanina123
30 parts Complete
Cherlninda died. 1009 years ago. Her best friend turned her into a vampire. Leaving her life behind. So in her earlier years in the years while hunting with her family. Her sister Alicesenia was attacked by a wolf and the wolf seriously effected Cherlninda. At school she sees this wolf again. Hes a alpha and 1009 years ago he was her boyfriend. They really hate each other. But... Even though they hate each other... They love each other... And they are mates... Impossible? Well believe it.
Shh - Eyes Down, Mouth Shut. by miniMina
18 parts Complete
Everyone has secrets. We treasure them, we keep them, we treat them like our nearest and dearest - our prize possesions. It's what you do when they come out that counts. And it's how you try to stop that from EVER happening. Especially when they're life-changing.
You may also like
Slide 1 of 10
The Three Of Us cover
I am the King, Right? cover
Runaway Bride (Editing) cover
Merely Lust cover
Stupid Cupid Had Me Falling For The Leader Of The Drapes cover
In the Absence of a Good Life cover
Something Worth Fighting For cover
Reality cover
Why do I love you? (COMPLETED!!! In editing process) cover
Shh - Eyes Down, Mouth Shut. cover

The Three Of Us

33 parts Complete

Ronnie feels as if she doesn't have a family. Ever since she was a child, she's been tossed from foster home to foster home. In every one of them, her foster family doesn't seem to really accept her and she just can't seem to accept them. To her, the possibility of ever being close to someone again seems impossible. Asher is living a fake life. Ever since he was nine years old and found his adoption certificate in his "father's" office, he's been pretending to be his "parent's" son. Nevertheless, he's been dying to tell them forever that he knows that they aren't his real mother and father. As they move from town to town, he realizes that it may be too late to tell them the truth. Avery feels insecure. Ever since the people he used to consider parents announced that he was adopted, he's been feeling nothing but distant and betrayed whenever they're around. However, he only sticks around for the angelic six year old girl that he still considers his little sister: Hartlyn. Three teenagers that have nothing in common besides the fact that they're all adopted meet in one high school. And now... they seem to be closer than ever.

More details