Blonde Jokes.
nataliecw
  • Reads 1,563,636
  • Votes 37,694
  • Parts 62
  • Time 35m
  • Reads 1,563,636
  • Votes 37,694
  • Parts 62
  • Time 35m
nataliecw
Ongoing, First published Feb 07, 2012
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Blonde Jokes :) if you think they're funny, you can tell them to your friends :)
Public Domain
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Table of contents

62 parts

Sign up to add Blonde Jokes. to your library and receive updates
or
#7repair
Content Guidelines
You may also like
Stupid Cupid Had Me Falling For The Leader Of The Drapes by AmariannaRose
4 parts Complete
**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?
In the Absence of a Good Life by ifindedcake
27 parts Complete
Meet Jimmy. He's the guy with all the problems, the screw up who always acts like a complete and total jerk. The one guy that's forever in trouble. Well, what happens when his habits get him into situations a little more serious than your usual high school jerk's problems? Jimmy's in a hole too deep to climb out of...and he's only digging deeper... (sorry, I suck at summaries...please give it a go...)
I am the King, Right? by cheesydancer
40 parts Complete
Michael Zanaya was crowned king of Arsom when he was only four. His father recently died of cancer and his mother disappeared when he was little. 13 years later, how can Michael deal with being one of the youngest kings with his Uncle Harold as advisor? What happens when one of his oldest friends comes back to him? This is a modern day monarchy, filled with misconceptions, secret plans and more than one evil plot :D
The Three Of Us by 830freckles
33 parts Complete
Ronnie feels as if she doesn't have a family. Ever since she was a child, she's been tossed from foster home to foster home. In every one of them, her foster family doesn't seem to really accept her and she just can't seem to accept them. To her, the possibility of ever being close to someone again seems impossible. Asher is living a fake life. Ever since he was nine years old and found his adoption certificate in his "father's" office, he's been pretending to be his "parent's" son. Nevertheless, he's been dying to tell them forever that he knows that they aren't his real mother and father. As they move from town to town, he realizes that it may be too late to tell them the truth. Avery feels insecure. Ever since the people he used to consider parents announced that he was adopted, he's been feeling nothing but distant and betrayed whenever they're around. However, he only sticks around for the angelic six year old girl that he still considers his little sister: Hartlyn. Three teenagers that have nothing in common besides the fact that they're all adopted meet in one high school. And now... they seem to be closer than ever.
Something Worth Fighting For by preciious-diamondz
47 parts Complete
What would you fight for? Your best friends, the people in your town, perhaps your country, or maybe even a second chance at love?
The blonde & The bad by lovelycodyfan
31 parts Complete
“Making friends is hard, falling in love is harder but falling in love with two wrong persons is astonishing easy. Still I would have preferred my life simple, no Guy, no Damon, no friends and no worries about people discovering my secrets.” As a typical teenage girl Jamey goes through life with a lot of secrets, some horrible secrets. That is why when she's sent to her first high school to make her senior year the best year, she wants to go by as unnoticed as possible. But as uncaring as the blonde girl is, she has a weakness. Guys. Yes the girl that had never loved a boy before, can only find happiness in unknown territory. Maybe that's the reason why she slowly finds herself falling for bad boy Guy Jackson. Making his way to her virginity, she tries to find shelter with an unexpected third party.
Shh - Eyes Down, Mouth Shut. by miniMina
18 parts Complete
Everyone has secrets. We treasure them, we keep them, we treat them like our nearest and dearest - our prize possesions. It's what you do when they come out that counts. And it's how you try to stop that from EVER happening. Especially when they're life-changing.
My Killer Romance by iguana95
35 parts Complete
Alice was perfectly fine living the highly secretive and cavalier life she had. Honestly, between the exotic locations and to die for gadgets, life couldn't get any better, and she was content thinking she was the only one of her kind. That was until she met him. Ever since that day on the airplane he's been doing nothing but turning her world upside down and then some. That is to say, in a world full of adventure she wasn't expecting this one.
SAVING LOVE:Book 1 of The Padmore Tower series by sweetP31lover
74 parts Complete Mature
"You don't want me..." I breathed, selfishly leaning into his touch. But I quickly pull away. "I'm different and so not your type," I muttered, looking everywhere else but at him. He frowns slightly, eyes simmering. "God, Anna." He exhaled, cool breath brushing my skin. " I've always wanted you. from the beginning. since the first moment, I saw you." He said, almost sounding painful. Michael gently cups my cheek with one hand and thumbs my bottom lip, and my heartbeat picks up. *** With the past years of a rough childhood, for 24-year-old Anna, Family, reading--the ocean, and her love for her job as a nurse--are everything. For 27-year-old Michael Padmore,--it was all about getting even with his father and his position as the CEO of the Vitality Tower. the past traumas of his childhood still haunts his heart driving him to unsatisfactory with everything he's accumulated. he finds himself choosing his work over his family. A year into their marriage, life's threatening obstacles are determined to pull them apart. He had her, he lost her and now after discovering truths from the past, he will do anything by to get her back. will the two fight for their love, or will it crumble with the lies and betrayal it started with? Will love conquer, rekindled or will it burn down to cinders? Trigger warning: Mature content, explicit adult scenes, violence, abuse, obsession. This book centers on family, drama, laughter, and sweet & heart-wrenching moments and is told through the heroine's eyes. Tag along, on this journey of love, deceit, and betrayal. The story just began...uncover it.
Reckless by ItsPrettyReckless
46 parts Complete
Some things are just unintended... like bumping into a conceited vampire at a party, hating his guts then - against all your better judgement and frequent protests - inexplicably making him believe that you've fallen in love with him. Then before you know it you're being sucked into a world of fantasy and danger that you had no idea existed. Of course, these things are just bound to happen to Anne Forbes - it's just her luck. She doesn't even want this, but who even asked for her opinion on these things?
You may also like
Slide 1 of 10
Stupid Cupid Had Me Falling For The Leader Of The Drapes cover
In the Absence of a Good Life cover
I am the King, Right? cover
The Three Of Us cover
Something Worth Fighting For cover
The blonde & The bad cover
Shh - Eyes Down, Mouth Shut. cover
My Killer Romance cover
SAVING LOVE:Book 1 of The Padmore Tower series cover
Reckless cover

Stupid Cupid Had Me Falling For The Leader Of The Drapes

4 parts Complete

**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?

More details